PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G16600.1
Common NameAtMYB43, MYB43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 327aa    MW: 37113.5 Da    PI: 6.1459
Description myb domain protein 43
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G16600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
      AT5G16600.1 14 KGPWTIEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.31.3e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E+++ +++++qlG++ W++Ia++++ gRt++++k++w+++
      AT5G16600.1  71 SEYEEQKVINLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      677***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-19563IPR009057Homeodomain-like
PROSITE profilePS5129412.261961IPR017930Myb domain
SuperFamilySSF466892.32E-2611108IPR009057Homeodomain-like
SMARTSM007172.1E-91363IPR001005SANT/Myb domain
PfamPF002495.6E-121461IPR001005SANT/Myb domain
CDDcd001676.05E-71661No hitNo description
PROSITE profilePS5129426.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2464116IPR009057Homeodomain-like
SMARTSM007171.9E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1471111IPR001005SANT/Myb domain
CDDcd001675.71E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009737Biological Processresponse to abscisic acid
GO:0030154Biological Processcell differentiation
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005352anatomyxylem
PO:0009005anatomyroot
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTIE EDKKLINFIL TNGHCCWRAL PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGLL SEYEEQKVIN LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLS EQEASQQAQG RKKSLVPHDD KNPKQDQQTK DEQEQHQLEQ ALEKNNTSVS  180
GDGFCIDEVP LLNPHEILID ISSSHHHHSN DDNVNINTSK FTSPSSSSSS TSSCISSVVP  240
GDEFSKFFDE MEILDLKWLS SDDSLGDDIS KDGKFNNSTV DTMNLWDIND LSSLDMFMNE  300
HDDGFIGNGN GCSRMVLDQD SWTFDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.88510.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250103_at0.0
Expression AtlasAT5G16600-
AtGenExpressAT5G16600-
ATTED-IIAT5G16600-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB43).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G16600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G16600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759900.0AF175990.1 Arabidopsis thaliana putative transcription factor (MYB43) mRNA, complete cds.
GenBankAY5196250.0AY519625.1 Arabidopsis thaliana MYB transcription factor (At5g16600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197163.10.0myb domain protein 43
TrEMBLQ9SPG70.0Q9SPG7_ARATH; MYB transcription factor
STRINGAT5G16600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  4. Brown DM,Zeef LA,Ellis J,Goodacre R,Turner SR
    Identification of novel genes in Arabidopsis involved in secondary cell wall formation using expression profiling and reverse genetics.
    Plant Cell, 2005. 17(8): p. 2281-95
    [PMID:15980264]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  7. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  8. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]